PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc005313.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family Nin-like
Protein Properties Length: 280aa    MW: 32399.1 Da    PI: 6.6259
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc005313.1_g00003.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK57.52.6e-18137182449
                   RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRki 49 
                              +is  +ls yF++pi +AAkeL v   +LKr+C ++GI RWPhR++
  Itr_sc005313.1_g00003.1 137 TISKAMLSTYFHMPIYKAAKELRVEYRILKRRCEELGIFRWPHRQL 182
                              79999***************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151914.129118206IPR003035RWP-RK domain
PfamPF020423.6E-16138183IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MANHVSSSSA FTNQIVYPSS DASEYPFWDA QCEQFPSTYF NAINNDEPLL NMDFDPFWNF  60
EHNLECLIGD TALNPLGMDG VLLPSASVIP IECDITPTSN AVAVKQDTTT GTKESMIEKI  120
VRRQSKRTKK NFRDPSTISK AMLSTYFHMP IYKAAKELRV EYRILKRRCE ELGIFRWPHR  180
QLELGSIEDD PELRDVLKEI KDRREMMLRN PHLKLHPAEI KLRDACTRKK RYREMMSFIS  240
PCTLPVPSFV VDHILPFTVD PPSRAMEENK SFQLLFDGFQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1162167RILKRR
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA42742142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.11e-17RWP-RK domain-containing protein